TTHERM_00016360

Length: 424 bp

protein Sequence

KQNKKIEIIKKEKERRSNPQMISKTQAFARLFQLSSKSFSTVKGGNLYTWGQYASGTGFETASAVPRKVDYFSGNVSKVAMGPYHTAVITNDGSLYTFGWGQNGALGNGAKEFQLSPSPVSFFNDKKLKVKDVVVGESYTIAVTENGEVYSWGYGGEPSSKINLDFFRNAILPQRCGALGSGDNKNRLTPQQIANLKADGYKNISGGDNFATLVNQSGEVINWGTGLFGSLGNGSDYPLFTPEVNAYFKHLKEHEGLTVQSIKSAGHFSAALLSNGKLYTFGVNTQGQLGIRENLGHNTDQNARLPTPVVDRHFVGQKVVDFEVGENTLVFLTDKNEVFFSGLELAYQPIRWEIPTDKKIVKLAASKDTFAAVTETGKIYQFNEFVGVSTNEVGNDYNVADSKAFEGKVVDLGGSYGIRFAIVN*