TTHERM_00024330

Length: 95 bp

protein Sequence

MVELKSGDTYIGVLEDVDRFMNIQLTEVTFTSKDEAVIDKAIEEQEILNEQKEEAKNKMKQKKEGAATQEKDGKQNKKFEKSRGGYKGKSKPRGS*