TTHERM_00028470

Length: 686 bp

protein Sequence

MRSFKLFILVSLAIFVLMSSSRQVNAELVTITQFSDIADKVRSNPNSLSAIMVTRLNQCERCNVGVKVFKEYAALVDGVVLTYLVDCEKVWENFEDQPRIPACDPEKKDQLPHITFFQPESDELDIYNKKNKKLPKDVPYQGMVSPDALMQKSKELLPSFIKTISNPKDIDNYLNFKEIPLKLVLFTDEEQPPLFLRALSGQYRGQVDFGLADVDNRKLKKRYNVSNFPLLIALKLSGTDYERADFSGEFTVPAVASFIQEQLKSMQVDKQNTKQNQGTYFDIPENVDVQELKPGQILAALKKYKENFVAFHLQKGKSSETAQIFDQLKQDFGNMFKYYQVQCNAECNEIFGSSLSTYPAVIIYPLSGTRNQQQFVKVNKYDDKNDLSSEILNSVLYSNLVESEVENDQDARKKIREGLDGKKYSVILAHDKYDHYQKLIFFIVTQQQRFRKYLNFVRYVNPTQSEIKNWSLNGVPGIVAVLELNDFQNTFRRSPYEQKDFQFKSVVDYLNQIAIQKQDEVVDQIKVEEIKKQEELEEKCLLNTEKPCLIALFDMSKEGKFKLDLEKINKIKKLYADRDIGYFYIDAKCHRELLQYFKIHDTNLNSLVYLDQKKTKYRLLKEAFELENLISFMDDLQGKKPKGLVALPGSIDLDERDCDAFNASEKQRLEQERLQKSKSKYKKDEL*