TTHERM_00046120

Length: 84 bp

protein Sequence

MSDNEEKKEVKPIKGDDGSLYFELDDKKRVTVRKFKGKLYVDIREFYEKDGEMLPGKKGISLNLQNWEQFRSLIDSIDQCITDI*