TTHERM_00046990

Length: 220 bp

protein Sequence

MSSLNQSIVNQDIHNTSNDADLKKNRSMRLMQRLEKKYSEQGDQKTLLENNENLETSSIQTNQSQEPAIKITSNEFKQNKPQQTENQGISGSEKLELMKKKDQIIEKYDRLSIIICAVLGVILAILSKQSMSVNFLLIFVSYQLLYQIIQRNFLLARINSLLNQGQTELNIGSFVSEKANKAINLISHVSRFSKVFRQLADDISAFLFTFVVFSQILQRF*