TTHERM_00047230

Length: 348 bp

protein Sequence

MRYLKIEKEKLVSCKKQEQEVQRIRRRKGNQKLNSIAKQQRVKRRDYQQNIKQNKEVKNPKKLIKQQIINKVKKRKKMFRGLTKFNKVFALNSFKNSLVAVPKANLNHVQNMLEENLKYDAQKYNDEVAVIQKTSRIYKPTYTIEFNREGEVLVYSADPIKNSVVYFKYPYVLYEAAIPLFIWAWIYNPLELSKNAVNSLLIYPNIAWIPRMWYWRSLQYKIQKMYLLRGGKVAKIETQSLAGDRFTSWVETYQFHPLTQDQKNFDNQDNAEFLEDEGQLKYELGVQLDNLQEMGTTSQDIVINFMKEGTVHHPELFEAIVKGYNIDTSDYVINTANNLRAREGNHNH*