TTHERM_00059500

Length: 59 bp

protein Sequence

MEQVFKSPIITSKTDFDNEPNVPQTEEDTQTPIFLYKNTLFSEQNKILSSNILASANYP*