TTHERM_00067000

Length: 147 bp

protein Sequence

MSAQKKHLLSKLRGQSILVIDTQKDTYSHLSELFEPSVKVLFSDDQNDSISIIQDKKPNLVFINCDSSIGAHTRFDGYEISQAIKQLEAFSLIPSIPVILYAKVNSILNKEKFRMSSADSLIISPFNEQIIIENLSQLPMYKFLIEQ*