TTHERM_00070770

Length: 326 bp

protein Sequence

MSFTTSFSDIFDNQKGVLQTGYVHNNFSTFSFTNQIQNQFKLKAKVYQRIENNGTTSVHNNGLLELDYKNDEWRFSKKIDVNRNISMRIDKLLQQEFVKGHTIFGKFDKDSDSQTESQHNPCIGVYKNFDKYAYKAKFNIETLVAQLKGKAVYDKHSSEDKEQYGTGVSASFDFKQNLFSNAKTLVYYNSLNTSMNMQYQMKRLQRVDDHEASSSQGGEIYYTFLYSLYQKLNDHLSIAVELNHDSNEKKFGMVFGGKYTKFDNVICRAKIDDKFIVNSSFEIDINKNIKFTISNMIDLSLRNKKDATTTSSHYSFPIGFQLDIQQ*