TTHERM_00079260

Length: 210 bp

protein Sequence

MEQEIDVDVSSQSQEQQEEKEPFEDLIQECDENARKLEILYIQKENEYQELCKTLSDLQDQIWNHQKEEYEQNSINTDQQIKKEIEQLSRLLAEKEEKIETYEKEISNKMDDDQLVRMRSKYKEIQQHKEINLRKQYKTAISGEQEQYPALRQYAEELKHELDVKKAIKEKLDEEIKKSDESIKELRRMKRDGASQEHELQEEIENLTQR*