TTHERM_00082150

Length: 120 bp

protein Sequence

MLKGIFEALAGNLVIIWVMFILCPVYLVLGNLIANFYKNIWLMVTSRQSWVYKNLGDLSWLFPFTQSSQQIRLTDTLLISVLCGILSLLIVVAMVYNNMQEKNQKRLEKEIKEEMDKKKN*