TTHERM_00082220

Length: 76 bp

protein Sequence

MSDLKDKAAQLLFSKISDIDTICYDKCVSTPQKKLNNNEEYCLKSCTIKLINALNFMHTLNENGGVDRIQPSKSNY*