TTHERM_00083650

Length: 168 bp

protein Sequence

MNGKKLKLSIWDTAGQEKWRTITTNYYKGSDGIVVAYSVEDQESFDKVGSWIESIKENCDNVNISILLVGNKSDSKQRVVTYEQGKKLAEQYNIPFQETSALDNINVTESFNQLAKMCLDQHEIISSKKKNQKSSSNDIDEQITGPSQSKKLTSKKKDENGESKKNCC*