TTHERM_00106960

Length: 245 bp

protein Sequence

MSGSETQITVFSPEGRLFQVEYAQRAVKNSGITTIGVRGKDCVVLITEKKTQESYVDMNSFTNIHTVSERVGAATTGYYPDSKAIVTRLRQEASEYKLKNGHFMPVDQLSCRLGDLSQVYTQKAFMRPYAVETILAGYDNELGPLLYKNDPSGYFCGYRAVASGIKEQDAIHQLEKEFKKDKNATSMSFDKTIEVAINTLKNILNREFNPTDIEIGVVSKEQPKFKKLNEQEIEEALRRTNQSKQ*