TTHERM_00145390

Length: 466 bp

protein Sequence

MSQLTMEQLQQAYGGLTLNTMDHKIYPDQKELSRGPGTACFLRYNKENPNIKPFVYKYADFKSEEEGARIRQEANYGIPLINREKYTQKVIDYVIGKNTFQGFYEYIEGESLFDYRERRKAESNPILYQEAAALTLEIWKILEPLHARNVSHKNIKPTNIIRKKSNGRLYLGDFSFGNILYGKMHFGIKFNEQMALYNLCFDADGMNESTIGLRLDGYSLVMLFCSLLGKKLCLGQFNKGNPTNFINMSGLNPPVPDVVIDNIKFLSIGDAFGNRQPLTEVIRILSMWSNSEAQIFKQIQYQVSDEIKAIANLEIMPDKVIMIHPCSNISDEQFFSYMTCLYNKQRQPYKKINIHFGGNMITQHSFFRMVDALENLNTSNLKNLSIQMNYNNLQNIYNFVIKFKQLKLPCLEKLSIGFKGNCNTSENEQILDTFSKLRQKYKQKINSKDPKNRERFIVKFSQDIVS*