TTHERM_00147560

Length: 191 bp

protein Sequence

MDSAFGLVGKDFVIVATDCSVAYSILKLKDKEDKISLLDQNKVMALSGEQAYRLQFSDYIAKNIALNKYRNGTEFNTKECAEFVRSELAYGIRNGPFMVNCLIAGFDNNQPQLYWVDYMGTLVKSVKAAHGYAAHFVLSTLDHDYKPNLTLDEGIAIIKRCINELKTRFLISQSHFIAKIVTPAGIQVLEL*