TTHERM_00149000

Length: 159 bp

protein Sequence

MSSEQNKDKSGNSLKSDTMISNLIDVEEIYKSQKLYKATPKLETKPIHLKPLELQQKSLFEAFFKGDQKYIYEFDKETLLYREKYIRKLSQQGLTVCLYTGGINWFVYQFVFKSSQHSIATKISSFTILNAIPLSYFAYKILVDYNKANEFLFERYLKQ*