TTHERM_00149110

Length: 206 bp

protein Sequence

MEKDTIATYKIVLVGDTSVGKTHLLKRYSKNELPKNSAPTIGVEFGTKEVTLKDGTKVKAQIWDTAGQERYRGILSLHFRRAVGALLVYDITKEKTYNSIMKWMEDLKYLADPDIVIMLVGNKLDLVTKTQENRKVSIAEAQQFALDNKLIFKETSAVLGTNIKEVFEQLLQEIYNQKKKNPQPQIPNNNIKDLTSTQRQNDDCAC*