TTHERM_00158210

Length: 267 bp

protein Sequence

KISKVINNIKSNKQQMSSNINLYDTDCSTWSTNGKLLQVDYATKAIDQGSITIGLRSQKFAVLVAQKRSNSKLSGYQEKIFQVDDKIGMGVAGITADARVICKYMRTECLNHKYVYGSQHPAQRLVIKISEKSQHKTQTYGKRPYGVGTLIIAQESDGPKLFQTLPSGDFYEFYGQSIGSRSQAAKTYLENNLELFKDCNDLNTLILHGLSALKKANQGEEELLPQSVDIAFVGLESNFTLLSEDRVLSYLQQLDTFAPANQMEVEN*