TTHERM_00161480

Length: 128 bp

protein Sequence

MCKHILNVQVAIRAPCCKKWFDCAECHNETQDHELKKALEMVFACKVCKKVFRKDLKDFDECDEYCPQQDIQNSLKFIHFSFFRNSSKLSFLILNFFTIKSSDFQLNYKISCDNKYILDAVTKEDKDS*