TTHERM_00185310

Length: 266 bp

protein Sequence

MGDDKEYQKKQREIEIENLNMRVLQLENKLKLYEDNELAKQRIIDSEVEKEKLKNQEIVDRFNQKFTFFEEQIQILEGQLLEKNRYILELETQNKDLNFFNQLVEEKQTLIESLRRENQVLIRRIREQFRDEAFGKEKFDFEEERKFIQEIIKKKEQQGLFVDGFVSNHRKDSQISESVRQQQNVEQNKRYRNEQIQQLSNYNNVTEEQKLASENRADSIIDRYEANQTQKKLSQQYPQPSEAEKEEIRKHQERLEKLKLKYRQSQ*