TTHERM_00188470

Length: 381 bp

protein Sequence

MADNREKVDSRKLYEDQKLLDILEQRSLQQDQSYREIYKKSHILQKQSQFQDDKIVKQSELDDLLGRIKKVEKLRQESKSYTWKDPQYYHAFIRKNLDLASNLTMETICLLVCYPFNTIKTRVQAKHPLEDISFFTKNNVSKYPLYRGIGQGMLGTFIGVTMNNAAYRWINIEMMKNQFVSNLSTFQKQLMCFCFADLLAAPFRLPFEVRKIYLQMNSGEISFNKYMNGMRSVLLPCLLRDLTYRIGFNTVFQLCLHGQNYAQMYSNNDPYQRQLIQRHIDRAIPNQSDYNKRITGMILGSLFAILISNPFDLAITRLVSQQYPKYDGFFHCLKTVIREEKWPKLFFSGYWARSVYYMISGSIVFNFYDTFRGMIEEAYQY*