TTHERM_00188760

Length: 125 bp

protein Sequence

MISKHSQAFEQLGYLFNKKEMYDNDAITLIQKADQLDPKDSWEGLSFLKKEILAFGKLGFLFQKKQMYDDAIKFYQKAFQIDPKNSWAFGKLGYLFYKKEMYDHAIPFFQKAVQLEHKYSWDYHF*