TTHERM_00188860

Length: 232 bp

protein Sequence

MTSTQVKLQQLDLQRKDIETQISALNKEIKYYEDKNYNKSLVDEEGFPRADLDFGELSTYKNLKRKFNGLGDLHEEYRESGQAQRDLEEYEKNMEIMKKTEAAEKAKKEYDEDMKDENLNAEIKKNILIPFAYINEVVDQSPAFQAGVKLNDLIVSFGPVNHYNHKELQFLIETVKSNVNKEIPVQVLRKNNKIQQSEQFYYKNENYELVNLTLTPRTWSGQGVLGCRFKLV*