TTHERM_00192090

Length: 414 bp

protein Sequence

MLSRILTRHFSLWAGVPKAPPDPVLGVAEAFKKDPATNKVNLSVGAYRDDNGKPVVLECVRKAQQIVIEKNLDNEYLPIQGNDVFTHAALKLGYGDAFYSSNKDRLAGVQVLSGTGALRTGFDFLKKFLPAETTVYVPNPTWPNHNNIARDAGFKVEFYTYYDPATKSVNFSKLLDEAKTFKNGSVFILHACAHNPTGCDLSINQWKELRDVFLKKNHIAFMDMAYQGFTSGDCQKDSEAVRLFADSNVNMLLGQSFAKSMGLYGQRIGSLSVLTQNANEAQNVLSQLKQVIRPNISSPPLHGARIAEIILTNPELLQLWYREVKIMADRIAQMRVQLVKNLKDVGSQHDWSHITNQRGMFAYTGVNKQQVESLINDYHIYLVGSGRISIAGLNTKNVGYVAEAFHNVTKNSKV*