TTHERM_00193700

Length: 756 bp

protein Sequence

MIGNLDKKRTDKRVVIGGIPKNNIDLRILEKPEKYTVVQKKKTYQDIKFIITCLKNHFVFYNLQDSQLETLVNEMSYCEVNQGEQVIKQGDDAFCFFLLEKGEIEVQVNQQKVRKLKDGEGFGELALLYNAPRSATCVALSKSYFWMIERNTFRKAVEEMITQEYQQNRKFIEKITFFQNLTSNQKDAIAGVLIDQRFLKEQNIVNKDDPASSFYIIKEGKVSVMLGDKEVRTLGQGESFGETALLQGDQTRTMTIKALEDTTCLALGRDVLTKLLGDKVEMIIYRNISKWALEKSDGFKELTINQLDKILDSIQISHITKGRVIIPKGTQKAQQLYIILKGSVKDGDIVYQKSQLLGAKEIINADETSVYEQNIVTEEDSVIGQVKISDLVAKLSGTLQDILKKNQKVSEQLEAKESQIRQNIENLTIDDLEVVKKLGNGQFGSVYLVKNKDTKQIYALKCVSKSSVVETSLEKHLIQEKKVMQTVNYPFIMRFFRSFKDDYYIYFLLEFIQGQELFEVIREIGLLSTWDSQFYIGSIILALEYLHSRKIIYRDIKPENIMITHKGYLKLIDMGTAKIMQTNAGTMTRTFTIIGTPHYMAPEVISGKGYSYLVDLWSVGICLYEFMCGYVPFGEEAEDPYEIYEEIIKKEINFPNYLSDPMAKSLMEQLLSRVPEMRTGGSYSSLKSHQFFRNVDWIKLSDMNYQPPYQPSNQSYLTTEQVLKAPGKQIQQQIKEEFGALKLPNASKVVDWDKIF*