TTHERM_00204150

Length: 242 bp

protein Sequence

MEGEELKQQELKVKKFIRKSRFTKRKERRQKLSQEAQAHKQKISEIRHLEKDFICAICLQYICCSTSTKCGHAFCETCLTEYELLFDKCLVCDSSIKNQEIRSCFLLDNLIQEFIERNHPSELQNFNKRKAECIQQRQKKQISDWQIGMKIDIRDSNNIWCVGIISRIQPNKNNQAQNIVVCYVNNLNIQEELPCASSRLAPFGLYSSRKDIPHYNNCQNTSEIVIHLPTLSDNVPQKLFIQ*