TTHERM_00209270

Length: 175 bp

protein Sequence

MIHQTEQYKIMKVAQIGGGYTGKSSLYLRYLQGEFIDNPNYIGVEFYTKTIKIAEEQIKFQFWDCHLNEKIYSLYQNYFKQCSIVMISYDITNRYSFDRAQLWCKDYNQKKLNKVALLALIGNKCDLEQQRQVSYQEGKHIAKSLGMLFFEVSSKTGYQVNELFESLISYVININ*