TTHERM_00221000

Length: 226 bp

protein Sequence

MKDQFRQEYDQIKKLQLSITRDITKREQMKIQGKSLGSIDSEIRGQLKSFESDILKITQLVQDQERNLQNLGLTAREIEQRRSMIVELEKQKKQQLDTLIQQDKMASKNQKMQKPANFQEKYDIEGQTNKQIYKYQQQELDSQDKQIQVMLSTVNKIKTGGQNIVEEVDDQVQLLNDLDIGLDKNTQLLNKNSGKLKNLLKTNSNFCLLTCVCLEIFLLMFFLIFL*