TTHERM_00225720

Length: 204 bp

protein Sequence

MQSKQDYDTLIKLLILGDSGVGKTCFLVNYCKKSFTRIHLPTIGIDYEHKYEDVDGKHVKLQIWDTAGQERFKTITQNYYKGSMGIILAYSVTDPNTFKNIADWMKQISERADPSVKIVIIATKIDMKDQRKVSTQEGEELAQKYGVKFFETSALEGTNVIEAFKCIASQALQTIQASSPINNFKIIQKPVIQSKKQEKDAKCC*