TTHERM_00284180

Length: 483 bp

protein Sequence

MIKKFVLAFLAFTQAILAAQDPQGKLLQVVETFRHGARYRIYNSSYPNNNQINYGELTAEGQRMHYVLGVTLQQNYAQSLNFPDKYDHTFIYAKSTNVNRTIMSAYSQLAGMFPLNKGIDVENINTQFMVPPFTKIADIGQQKYALAGGQQPIPIHVKEQKDEKQLLGYGDACNNSPKWSQKNKDDSDWNRIKGEFQPLIDKLANNKFFQLPANPDLDTIAQLVDTLIAIKWAGDDAQNTLIAAQIEGFLLPLDEMMNPNNFNVMWVQMNLLYSIQLHLALFKTEQQKKTSVTPFFNELLAYFNNYLSAKDTQNPFFKWIMLSAHDTTIAMVAQGLNLTSWQCMEQVKNQTFASNPSSPCIYTYPGFASNIIFELYEDNNKKPYVKALYNGTAQPLCGTADTFCYLDQFTQSISYSIVSDFDKECDNPIYVSSPDSSSTPTWAIVVIVIVSVLFVGALGYIFFQRKKILSLQSIDKNSNYSQI*