TTHERM_00285420

Length: 153 bp

protein Sequence

MEESYKFAEGQKESWMKAKTTDQLCDFLEFVSLHITNKSVINDVVQIFLFLEQVNQKLISDQEFLAGQQNKNYIYSIEKDTILNRKIRELLVLIEQDIQKFLCEDREMLTYIQKELDFIQNCCISSIIPFKEQIIYIVSMVYSALTTFENTLN*