TTHERM_00294550

Length: 238 bp

protein Sequence

EVKLQVWEKRDQIGTSGAGVSHSIWNKIANQPDDPDNKKVQNTSSLLYQHADEKAKSILDLAISHQVTVKPGACKKCGHIGHLTYQCMNLLSKGFQIDKYKEEKQQESAEEQQKEMLEKLRQQKEQWKRAKEEKKRMKKEQKKKSKKSKKDKKKKKKRSKSSSDSDSESSRSSSRSRSASSENSIKSDSLSDDERQKSSKKSKKNKSEKREQNSSRSRSRSQSKSPKKSGKKIKKDKK*