TTHERM_00297170

Length: 199 bp

protein Sequence

MQLPKKDLFFYTDRESLTTYVYYKNKLDQNYKKAIYYPDQYETMTNSQIEAYRRQVNLKFLKWSFFNKDKIHESADRRIITSQLVDLNFGLLGCACVGLIFFKFLKRIEAPFLEMYLEDKVLGLNSLRLIASSGISIYGLNYIYKHIFGQKYLQDLSLEYKEQFLPNQIVDSKVEGIIQKYFPLQKDQQTTQTVEPQQK*