TTHERM_00304350

Length: 185 bp

protein Sequence

MDQNNQTKEQSQQKEEVMTNIEQGDENIKEDNYSCDLVFKLLNGIKFTTLDHKPCKTSEESAQVRGVSLDSGAKAMLLKDKQNITFILAVMSASKKLSWKLIRGIVGHKKLDLAKPEEVYSLTKCIPGAVPPFGSIWGIKTLTDQSLLDQGDVINFNCGLRTKSISMKTEDYLNVEKPQVCQFTE*