TTHERM_00310820

Length: 411 bp

protein Sequence

MDKKKPLVLKYEEIQNYSQVLETHKFLQDLGNVIIDNTINSAKNVSIAADNLSRTQIPLLVLQLILKRYGSEKEQRVNLDHFDLSEKGIIRRVGIIAFASAVGEALAYPFDRLKVREIARQTFTTKSIFKETKVIYEDILKAEKSFGVFYGLRAGIDRILSQNLVRFFVFDFLVGRPLQPYSQISDFQLYVSAIAAQSMSFLIQQPSNILKIKIQCEPLGVDYTKYESYQEKYRKISQYHKGKSTIFMGTGIRSGLILQNSIAVSEIFIFFKFLRYFYEETEIKSDGFKVCTSALLTSLITTSVTHPLDFIYHRYCIRALQASEIPSINKYIQQLIKEDMGIFTLYKGIVPSLIRNSIFTLTTFSLWNYFTTVRRHEALYNYYSRKYEEKLMKSDSHHNYEMTGGRKNVRD*