TTHERM_00314870

Length: 202 bp

protein Sequence

MKLIAILCACKNSTDKQVYIPIREYEDSSISVFQRGKVRNLFKFIVSESFVGIQKGTRHEVRHEDYHIYILSSLTHDVVAYAFTQGEYPRRVIYKGLEKVLDGFFSQLAIGYQGIKSDEKIKILAIQQILKDYSDPANVDQLTKVLNKVNEIQVILHEDIQKLLEAQGDLGILVEKSKYLDNAAKQLYKNSKKVDKNCCSIF*