TTHERM_00316040

Length: 240 bp

protein Sequence

MSSQDSRISDEEFERRLNAKSYNTTYRAPDEQNVQKDKYIDDWFKSQRQQSGQTLLNEIKEFEEQKQLQNFTQQQTGATQALPPNAINSQQSKFFNETKILFPKELKFENFLNDKYASFYYFSHHPKTSNKFEISDIDTSDRLLKSRNTGYLTTWLSISLVSYYMTKYLKHSNIPWGITYKFTFIGFLAKYLFFPSVMSSTIDKYLLAAPFEKRLDQIIQKYSLSSDPLFREVFESQQKK*