TTHERM_00338450

Length: 97 bp

protein Sequence

MGGCSGKNNPKMKIYIEHSTEQNIIEAYNLTNLQINQQLKIQVSEQIKSNQSNIFTVYVINPGHNREQVWSIQQGDELISQYNIKDLIEKIKDLSQK*