TTHERM_00338550

Length: 244 bp

protein Sequence

FLDMQEAQQDLPQWLKALKRSIINNRQLQFSNMSQIAYVFNGEAGIDNITFDSYEKVISDNPLQEYSLIYTIDSRKNTFNEMKNNKVVELCWYFPLTKEQYKIKCHFSFIALQQTQINDIQITEEILIEQLPQNQRELLENAWNKVDKEAKKLYQSPHPDTCKPNQEPLDDLERFNTPEKNKISNNFALLVLTPFRMEHTSFAMPQVVADGRKEFESIFKPYKKHSKYLYVIENNQWKVHTLNP*