TTHERM_00346810

Length: 340 bp

protein Sequence

MSQVKQEEKSLVEELQLDSIIQRDFPKIDFAFGYGSGVFRQIGYDYSKDSPMIDLIFGVQDADEWHRMNLIKNPSHYSGLGYYLGSSYLHFLQQYITPVHFNPSIQVDSFDQKRKLNIKYGVVDVKQLSKDLLKWNILTCSGRLHKPVKIIQLDQVQNPTLNSDLRVNLIQATAISLLLNFKPYIEMKEFLMTIASLSYIGDVRFLFGAENKNKIQNLVEGNYDRFTHLYKDVIEQNNPINSLAQVVGNRAEHIKLETNSETVYQLVNCLPDGLGLFARTNEINVKIINLEDVQRQIIERIRKINMGSSQKLILYNTLATSPTKNIYYVFKKLQKGILKR*