TTHERM_00347920

Length: 223 bp

protein Sequence

MDTEFQKKLIPKVQSREDILNESYKNSIHAFLYENKVYDCLPKNSQVVVIDKNFSCAEAMNLVIKNDFEEAIIWNQDTSQFDGIITYSDIVNIILKSYKNVALGQIPLSDSQRQTQGFDKLQEEFKKFNEDDQMADDNDVGVYSKNENEMEDEDIKLNNNKTSIPMNQSIKLKGQEQEFHAENYPFNEDQKQIFLSDLQKLSVRGWFRILNQDIRKVSQLQVS*