TTHERM_00348200

Length: 527 bp

protein Sequence

MHTMTNSHYNMKSKFLDTLFDNILNWLGPKKRKRDDISIGEYDGEYPRIPDPSKKVFKSSDQFSSSNDQKLANNNNNSSSANQSSDDVPQIIHSVIPIKNNTSPRKEAQYQQINKKDIIDHNKENSNTKVKLQNQPNPKVIVLNECNGNSKKNEFQLNGKKEAQLQEFIVIEEDGIEQANHSYFNQKIVDKQLQLARRPSSAQYQIEQDRKQRENLDLEIIQLPKEFMEFKEITDEWISNDFGLLEQKMAKLDLQTQQIKQHNSFIYFLNYRKVGELLEEFNQIYDLKTKKMKKLFWRFEEKQLKEVQDVFERSFNLNQDVVTHQHILERLTFSNLQTLRQPNWLNDEVINAYIRLIVQSTNAVILNTFFYPELVKNSAWNKIKRIATKNKVTYKSGNFFVPMNINGTHWSFVEVNNETNKIIYYDSLATDDRDYFNYTKYFVDLMQNLQKDDGIAQENIKKYELINGETGFQQNGYDCGVFMLKGIHYRSSGINGLRLWIEQTDTQYYRYLIAFQLIQGKVEICQN*