TTHERM_00353560

Length: 257 bp

protein Sequence

MERQNLLKYVYSKNINPKLNLASKTANIDSELDARVNIVQNQKTDQPAEVTCQPIYTQIAASSDTCSLGGPISPQGLIQYLFKKKESDYKYKLILNNPLEQPLYRERNFNINVSLVDRDDNAVSNNNRIPLNISIYTSENPPKFIDTNTSGNKILKGFTEKDLQQGQITFDKIQIKEVTSHFRNGWVFIVIFPKQLNYESGKSIHRKDDIDINEIRPLIIEKVVVKAKKLKEGKKQKDGNNSNDDSKEQSNEKIEDN*