TTHERM_00353570

Length: 224 bp

protein Sequence

MCLLDARCRCENGQCSHIGNQMPFNQLFNPQFLNQDAFQVLDQTKKLLSQKTEIINPIVKKVKRENDFIQQAEQNENVNNLNSMVAENVDNSNFQFQQNLLPLLNQFQPIKPVNYGIANTSAVAANQTQQNNNSIQNSSFLIKPSPFQASNNGLPTVSNNLETLLKDMQARVMGMFAFQSKMLTELQEKSNMQAQTINLLFDEVKQLKQYFKFSYLLNNLWDII*