TTHERM_00355270

Length: 233 bp

protein Sequence

MEQLFTKVLNPKLNKILAIGKNYVKHVKEMGGSEVPKEPVIFQKPHSSVLPNIQKGQKVQFFTKNEVHHEIELGFMMSKEASHKSFQKSGENWQDYVGGYFLALDLTDRNLQAAAKKAGFPWDLSKGQDKFLPISSFIPKEKVQDPYNLTLHLRINGKTIQKDNTGIMHFKIKDQIEYASKFMTLYPGDLFLTGTPDGVGPIKHGDHVVAELLEGENVLAQIDFVAEMVAPAL*