TTHERM_00374960

Length: 311 bp

protein Sequence

MSSNIEDLMNKKAQEIKLEENKQIKPKIHYKSFIAGAMLTFIAQPFEVLRTSSVFLNHWGTKPSEILNLSKFIYQKEGVRGFFRGGTIAAVKSSLGFGVFFNGIQNIPYILKTQTKSPEHYIYNQIVNFINGSSAMFFTTMASTPLTVLKTRFEVVGQQEYTSVIQTTKKIYAEEGLRGFYKGIIPTLMRDLPWSGAQYSIYQSLISMYEYFLQKPANENNLFIFLSGALSASASIMIFYPFDNIRVRYQGVRQQNTPLLKLAYHIYQVEGFKGFYRGYLPRLLKKGAQGAIAWTIYEYLKKDQKKKEAIN*