TTHERM_00384680

Length: 349 bp

protein Sequence

MIKRKYRNQNGVDYIQGKLITMPQTNTTSSSSLVIKKDDKQSFARVIRMQSEKKLTNNDSFRSESRQKLIRDVYTPSQKDKLNQSIRKLNSSQSRQSVNNSSQKNVLYGMNKSQTQRKSSAKEQVRMIQNNLAPQDKEQQFSMKNQMIIAKNNEKQIGASLILIQFLLTNRDKQFKSLSKLVDYNLYKNQSSNNRSQLQGRSSMHATTNQSILKVQQLQNNQSSKTTYQNQKNYHNQNKPQLIEINGNSSSIHLKNQSLAIQTSKALSSNSGNLPLLTSKSNTLGSPSSQPKTFRYGTESVQIKENKIIRQKDQPRYNYPKKYENKIANSHQLPSNLQPKSRANNNKMY*