TTHERM_00384780

Length: 78 bp

protein Sequence

MNTVVQIVGVIGGCVIGAYSVNVLMTSLGINQRGKQQQNNQQFQQPYQQNQNVLDQAVSDFVNSNQNNQNTGSRNRDY*