TTHERM_00393080

Length: 279 bp

protein Sequence

MGQSQSQENEDEKEDKTQNEKKKSEKIQISPYVDGMPVLQSKLQKLIKKEDNEKQQNNEVYQMKESKEINTDIHQEIQLIEQNRFQNCSDHIRQEFESFSNENKMSQRKLLEYFGLQDLEKQRLGTRFFLTCKSTLSQEKTGPYLDYSKFLKTLSMLSGNNEDGRFQFLYQLFDINLDGKIEKDEMRDILQMILDALLSVTYEDDDLKNLSKKIQGEQERMISLALDQITSEIFDSANESNSINFQKWKNWISQIEGFQQVIRFDPQANSNNTYTQQKN*